EMPIAR-13371 - Clostridium butyricum Argonaute catalytic mutant in ternary form (bound to guide DNA and target DNA) and de novo designed Dimbd2 [12538 multi-frame micrographs composed of 50 frames each in EER format]

EMPIAR-13371

Clostridium butyricum Argonaute catalytic mutant in ternary form (bound to guide DNA and target DNA) and de novo designed Dimbd2 [12538 multi-frame micrographs composed of 50 frames each in EER format]

Publication:

Target-DNA binding-induced dimerization is required for catalytic activation of Clostridium butyricum Argonaute

Barendse P, van Drimmelen M, Pacesa M, Sivaraman A, Zhang DK, Nickel L, Niault T, Lindhoud S, Roosjen M, Hegge JW, Park K, Correia BE, van der Oost J, Joo C, Westphal AH, Swarts DC

(2026)

Related EMDB entry:

Deposited:

2026-03-14

Released:

2026-03-18

Last modified:

2026-03-18

Imageset size:

4.00 TB

Imageset DOI:

10.6019/EMPIAR-13371

Experimental metadata:

Download xml json

Contains:

micrographs - multiframe

Image Sets

1. Movies of CbAgo catalytic mutant in ternary form, complexed with guide DNA, target DNA, and de novo designed dimer disrupting binder Dimbd2

Category:

micrographs - multiframe

Image format:

EER

No. of images or tilt series:

12538

Image size:

(4096, 4096)

Pixel type:

32 BIT FLOAT

Pixel spacing:

(0.57, 0.57)

Details:

Sample of catalytic double mutant D541A, D611A of Clostridium butyricum Argonaute in ternary form (mix of monomers and dimers), bound to single stranded guide DNA ([P]-ATTTATGTGATTTTTC), single stranded target DNA (GAAAAATCACATAAAT), and BindCraft-designed de novo dimer disrupting binder Dimbd2 (KSFEEKKEIVIGMLRYMLENFEEYVELYPDNEVLQTLVPEFKKLVEELESETDKEKFLEKLKEISEIYAKLLKEIFGDNGRSLEELKEKIFVHFSGALE). Purified in buffer 20 mM Tris-HCl pH 7.5, 250 mM KCl, 5% glycerol.
50 frame movies, with a 50 e/A^2 electron dose, on a 300 kV Titan Krios with Falcon 4i detector, with 2.7 mm C2 lens, collected with a 0.57 A pixel size.

Files:

This entry cannot be downloaded from PDBj.

Archives and downloads the selected files into an uncompressed zip file.

Depending on the number and size of files to be downloaded, this can take an enormous amount of time. Also, this feature is unstable and may not work properly, and checksums of downloaded files are not verified.

We recommend using rsync, aspera, globus, etc.

Download a list of selected files.

It is possible to download files by specifying the file list with rsync command, etc.

rsync -av --files-from=(path-to-filelist) rsync://empiar.pdbj.org/empiar/archive (path-to-destination)

Browse All Files

Quick Links

Browse EMPIAR

Sample Preparation Widget

Volume Browser

Tomo Viewer Prototype

Claim entries to your ORCiD

Talks and Tutorials

EMPIAR Quick tour

Publications

Re-use study

Statistics

EMPIAR in the news

COVID-19 Data Portal

EMDB

BioImage Archive

PDBe

EMNavigator@PDBj

PDBj

Citations

prismPYP: Power-spectrum and image domain learning for self-supervised micrograph evaluation.

He L, Bartesaghi A. (2026)

CryoSIP: unleashing protein high-resolution Cryo-EM via semantic-instance collaborative picking.

Deng Y, Wang S, Xiang M, Li Y, Zhuo L, Cao D, Fu X, Zou Q. (2026)

Chart builder: an interactive tool for user driven data visualization in the electron microscopy data bank.

Fonseca N, Duraisamy AK, Wang Z, Somasundharam S, Tayebinia M, de Oliveira LC, Ma M, Turner J, Patwardhan A, Kleywegt GJ, Hartley M, Morris KL. (2026)

CryoVirusDB: An Annotated Dataset for AI-Based Virus Particle Identification in Cryo-EM Micrographs.

Gyawali R, Dhakal A, Wang L, Cheng J. (2026)

Deep-learning methods for contrast enhancement and artifact reduction in cryo-electron tomography: a systematic analysis of the state of the art and proposed improvements.

Jones HN, Deshmukh A, Pande K. (2026)

CryoGS: High-Quality Cryo-EM Homogeneous Reconstruction by Gaussian Splatting

Zeng B, Liu S, Cheng S, Xu G, Fan H. (2026)

Point cloud deformation modeling for particle selection following cryo-EM 2D classification.

Wang X, Mo Z, Li F, Zhang F, Wan X. (2026)

ICECREAM: high-fidelity equivariant cryo-electron tomography.

Kishore V, Debarnot V, Righetto RD, Engel BD, Dokmanić I. (2026)

CryoSift: an accessible and automated CNN-driven tool for cryo-EM 2D class selection.

Schäfer JH, Calza A, Hom K, Damodar P, Peng R, Bogdanović N, Lander GC, Stagg SM, Cianfrocco MA. (2025)