EMPIAR-13371
Clostridium butyricum Argonaute catalytic mutant in ternary form (bound to guide DNA and target DNA) and de novo designed Dimbd2 [12538 multi-frame micrographs composed of 50 frames each in EER format]
Publication:

Target-DNA binding-induced dimerization is required for catalytic activation of Clostridium butyricum Argonaute

Barendse P, van Drimmelen M, Pacesa M, Sivaraman A, Zhang DK, Nickel L, Niault T, Lindhoud S, Roosjen M, Hegge JW, Park K, Correia BE, van der Oost J, Joo C, Westphal AH, Swarts DC

(2026)

Related EMDB entry:
Deposited:
2026-03-14
Released:
2026-03-18
Last modified:
2026-03-18
Imageset size:
4.00 TB
Imageset DOI:
Experimental metadata:
Download xml json
Contains:
  • micrographs - multiframe
1. Movies of CbAgo catalytic mutant in ternary form, complexed with guide DNA, target DNA, and de novo designed dimer disrupting binder Dimbd2
Category:
micrographs - multiframe
Image format:
EER
No. of images or tilt series:
12538
Image size:
(4096, 4096)
Pixel type:
32 BIT FLOAT
Pixel spacing:
(0.57, 0.57)
Details:
Sample of catalytic double mutant D541A, D611A of Clostridium butyricum Argonaute in ternary form (mix of monomers and dimers), bound to single stranded guide DNA ([P]-ATTTATGTGATTTTTC), single stranded target DNA (GAAAAATCACATAAAT), and BindCraft-designed de novo dimer disrupting binder Dimbd2 (KSFEEKKEIVIGMLRYMLENFEEYVELYPDNEVLQTLVPEFKKLVEELESETDKEKFLEKLKEISEIYAKLLKEIFGDNGRSLEELKEKIFVHFSGALE). Purified in buffer 20 mM Tris-HCl pH 7.5, 250 mM KCl, 5% glycerol.
50 frame movies, with a 50 e/A^2 electron dose, on a 300 kV Titan Krios with Falcon 4i detector, with 2.7 mm C2 lens, collected with a 0.57 A pixel size.
Files:
Loading...
Yu C, Xu Z, Zeng Q, Wan X, El-Messiry H, Zhang F, Han R. (2026)
Poudel B, Gyawali R, Dhakal A, Cheng J, Xu D. (2026)
Deng Y, Wang S, Xiang M, Li Y, Zhuo L, Cao D, Fu X, Zou Q. (2026)
He L, Bartesaghi A. (2026)
Kong L, Zottig X, Elferich J, Grigorieff N. (2026)
Gyawali R, Dhakal A, Wang L, Cheng J. (2026)
Fonseca N, Duraisamy AK, Wang Z, Somasundharam S, Tayebinia M, de Oliveira LC, Ma M, Turner J, Patwardhan A, Kleywegt GJ, Hartley M, Morris KL. (2026)
Jones HN, Deshmukh A, Pande K. (2026)
Devarkar SC, Lomakin IB, Wang J, Grada A, Bunick CG. (2026)
Geißler K, Kreysing JP, Wang Y, Glushkova D, Obarska-Kosinska A, Hoffmann PC, Böhm S, Schmidt A, Meier-Credo J, Langer JD, Hummer G, Beck M. (2026)