Clostridium butyricum Argonaute wild type apo protein complexed with de novo designed binder2 [7097 multi-frame micrographs composed of 50 frames each in EER format]
Publication:
Target-DNA binding-induced dimerization is required for catalytic activation of Clostridium butyricum Argonaute
Barendse P, van Drimmelen M, Pacesa M, Sivaraman A, Zhang DK, Nickel L, Niault T, Lindhoud S, Roosjen M, Hegge JW, Park K, Correia BE, van der Oost J, Joo C, Westphal AH, Swarts DC
Sample of wild type Clostridium butyricum Argonaute apo protein mixed with BindCraft designed de novo binder2 (SEDYEMIELFSAQFIWLIAHDIAKMEGWENEYLHEVIDYMDKIIEKIEEKYGNQDPNELFEKHFNSWSKEKQEKFRKVFDELFDKLMKEIGFFDWPNLDAKEFAERLKKAHEKLVEELAKALGIKP). Purified in buffer 20 mM Tris-HCl pH 7.5, 250 mM KCl, 5% glycerol. 50 frame movies, with a 50 e/A^2 electron dose, on a 300 kV Titan Krios with Falcon 4i detector, with 2.7 mm C2 lens, collected with a 0.658 A pixel size.
Files:
Available download options:
This entry cannot be downloaded from PDBj.
Archives and downloads the selected files into an uncompressed zip file.
Depending on the number and size of files to be downloaded, this can take an enormous amount of time.
Also, this feature is unstable and may not work properly, and checksums of downloaded files are not verified.
We recommend using rsync, aspera, globus, etc.
Download a list of selected files.
It is possible to download files by specifying the file list with rsync command, etc.